DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPA12

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_320731.3 Gene:CLIPA12 / 3291430 VectorBaseID:AGAP011781 Length:379 Species:Anopheles gambiae


Alignment Length:397 Identity:105/397 - (26%)
Similarity:161/397 - (40%) Gaps:88/397 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALPGIQILLLIASVSVVTEYCDNGTGEC-------KELT----PSDCP-------VIFYNQHLIG 49
            |..|:.:|::..:.:|..:.|:   |:|       :.||    ..|.|       :...|.:::|
Mosquito     8 AAVGLMVLVVALTPTVDGQTCE---GKCVPLKNCLRPLTAEGEDDDAPAPEVDLRIGQENSNVVG 69

  Fly    50 AEVKY---CDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQ---CKQYNEVRSACQSTPFIVGGTK- 107
            ....|   |..|.|:|          .:||..:...|.:   |.|.|:     ....|.:|..| 
Mosquito    70 NCSHYLDTCCAFEDVV----------EEPAAHSTTQEDEFVPCGQRNQ-----NGVGFRIGAGKV 119

  Fly   108 --ASGKEFPFMALIGTHRPNKSKSDIN--WDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDS 168
              |...|||:..|: ........|::.  :.|.||:|.|...||.|||:           .|..|
Mosquito   120 EEAEFGEFPWSLLV-LEMKELFDSELKEVYACVGSLVAPNVALTVAHCV-----------INKTS 172

  Fly   169 PKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAA 233
            .:.:||.||.|..:.::....||.||...::|..|   ::...|  |:||:.|.:..:..::|..
Mosquito   173 TRLLVRAGEWDTRTESEVLPYQDARVKEVLIHDRY---NKHHHF--DVALLVLVQPFQPAENVQT 232

  Fly   234 VCLPPDS-----GNDVQQVTAAGWGFTADGVKS--SHLLK-VNLQRFSDEVCQKRLRFSIDTR-- 288
            :||||..     |:   :....|||....||..  .|:|| |.|.......||:.||   .||  
Mosquito   233 ICLPPPGVRPPVGS---ECLTGGWGKDRFGVMGVYQHILKRVELPIVDSAQCQQALR---KTRLG 291

  Fly   289 -------TQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKV 346
                   :..|||. ...||.|:||.||.:....|.........|:|::|:.||.:.:|.||..|
Mosquito   292 AGYKLHSSFLCAGG-KKDADVCSGDGGGALVCLMPGSQTNYYQAGVVAWGIGCGDENIPGVYADV 355

  Fly   347 HLYTDWI 353
            .....||
Mosquito   356 ESSRGWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/274 (29%)
Tryp_SPc 102..353 CDD:214473 78/272 (29%)
CLIPA12XP_320731.3 Tryp_SPc 120..362 CDD:214473 76/265 (29%)
Tryp_SPc 120..362 CDD:238113 76/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.