DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP004567

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_313871.5 Gene:AgaP_AGAP004567 / 3291034 VectorBaseID:AGAP004567 Length:321 Species:Anopheles gambiae


Alignment Length:309 Identity:87/309 - (28%)
Similarity:138/309 - (44%) Gaps:64/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PAEQT-RPFEKQCKQ------------------YNEVRSAC---QSTPFIVGGTKASGKEFPFMA 117
            |...| :|..:.|.|                  |....:||   :::..||||..|..||:|::.
Mosquito    36 PISSTMKPPPRDCSQCCMYTRCMLLGHVIKVPTYFLYLTACGRGKTSSRIVGGDAADVKEYPWIV 100

  Fly   118 LI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELD 179
            ::   |.           :.||||:::.::::|||||:           .:|...:.:.:|.:::
Mosquito   101 MLLYRGA-----------FYCGGSLINDRYIVTAAHCV-----------LSFTPQQLLAKLYDVE 143

  Fly   180 YNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDV 244
            :......|:|:.:.      |..:..:.    |.||||||:|.:..|.......:|||. :|...
Mosquito   144 HGEMVTRAIVKLYG------HERFSLDT----FNNDIALVKLQQPVEAGGSFIPICLPV-AGRSF 197

  Fly   245 --QQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQK-RLRFSIDTRTQFCAGSMSSQADTCNGD 306
              |..|..|||..|:|..|..|.|..:...|:..|:| ..|.|..|....|||......|.|.||
Mosquito   198 AGQNGTVIGWGKLANGSLSQGLQKAIVPIISNMQCRKSSYRASRITDNMLCAGYTEGGRDACQGD 262

  Fly   307 SGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
            ||||:.|....:   ::::||||:|..|.....|.|||:|..|.:||:|
Mosquito   263 SGGPLNVGDSNF---RELVGIVSWGEGCARPNYPGVYTRVTRYLNWIKS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/260 (30%)
Tryp_SPc 102..353 CDD:214473 76/256 (30%)
AgaP_AGAP004567XP_313871.5 Tryp_SPc 84..306 CDD:214473 76/257 (30%)
Tryp_SPc 85..309 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24258
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.