DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP007141

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_565054.3 Gene:AgaP_AGAP007141 / 3290313 VectorBaseID:AGAP007141 Length:254 Species:Anopheles gambiae


Alignment Length:270 Identity:76/270 - (28%)
Similarity:119/270 - (44%) Gaps:58/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPF-MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPN 165
            :||||.|.....|: ::|.|.         ....|||:::...::||||||::|           
Mosquito    31 VVGGTDAPPGAAPYQVSLQGL---------FGHSCGGAIIDRDWILTAAHCVQT----------- 75

  Fly   166 FDSPKFV-VRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
              |.||. |.:|     :...:|..|.:.|..:.||..|:    ...|.||||||:|....:::|
Mosquito    76 --SVKFTKVLVG-----TNLLNAGGQRYAVEKFYVHSRYN----NPVFHNDIALVKLKSMIQYDD 129

  Fly   230 HVAAVCLPPDSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFS--------I 285
            .|..:........:...:|..||| .:..|...:.|..::|.....|.| |||..:        :
Mosquito   130 LVQPIAYSEREIPENATLTLTGWGRLSGTGAMPNKLQTIDLTYVPYEEC-KRLHGNSENVDIGHV 193

  Fly   286 DTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYT 350
            .|.|:...|:       ||||||||:..:..|       :|:|::|:.| :.|.|..|.:|..|.
Mosquito   194 CTLTKKGEGA-------CNGDSGGPLVYEGKL-------VGVVNFGVPC-ALGYPDAYARVSYYH 243

  Fly   351 DWIESIVWGN 360
            |||.:.:..|
Mosquito   244 DWIRTTIANN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/264 (28%)
Tryp_SPc 102..353 CDD:214473 73/261 (28%)
AgaP_AGAP007141XP_565054.3 Tryp_SPc 30..246 CDD:214473 73/261 (28%)
Tryp_SPc 31..249 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.