DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005709

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_556350.3 Gene:AgaP_AGAP005709 / 3290027 VectorBaseID:AGAP005709 Length:268 Species:Anopheles gambiae


Alignment Length:272 Identity:69/272 - (25%)
Similarity:110/272 - (40%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAER 161
            ::.|||||...:......|                   |.|.::.|:.|||.|.|:.        
Mosquito    39 RAVPFIVGILISGSSSHSF-------------------CAGILISPRHVLTTASCVS-------- 76

  Fly   162 LDPNFDSPKFVVRLGELDYNSTTDDALVQDF-RVVNYVVHPGYDTEDEEQGFKNDIALVELDRKA 225
                 :.|...|.||      .:|...:|.| .|.|.::||.|.:...    ::|:|::.:||..
Mosquito    77 -----NRPTLTVLLG------ASDMTRIQQFIGVANILIHPNYSSLFN----RDDLAILTMDRDT 126

  Fly   226 EFNDHVAAVCLPPDS--GNDVQ--QVTAAGWGFTA----DGVKSSHLLKVNLQRFSDEVCQKRLR 282
            ..|:::....||..|  ||...  ..|.:|||.|.    :.:.:.:|..:.....|:.||.....
Mosquito   127 PLNEYIQVANLPRWSHMGNTFNGFGTTISGWGNTGNRDNEPIPTPNLQSIRTPVISNTVCGISHN 191

  Fly   283 FSIDTRTQFC-AGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSY---GLVCGSQGLPSVY 343
            |..|  ...| :|.:..   .||||.|||:.:.....|.   |||:.|:   ||....:|..:|:
Mosquito   192 FIRD--DHICTSGDIGG---PCNGDDGGPVTITEAGQPI---VIGMHSFHYSGLFGCDRGRSAVH 248

  Fly   344 TKVHLYTDWIES 355
            .::..|..|||:
Mosquito   249 VRLSSYLSWIEA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 67/267 (25%)
Tryp_SPc 102..353 CDD:214473 64/263 (24%)
AgaP_AGAP005709XP_556350.3 Tryp_SPc 29..258 CDD:214473 66/268 (25%)
Tryp_SPc 30..261 CDD:238113 69/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.