DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005687

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_556332.3 Gene:AgaP_AGAP005687 / 3290023 VectorBaseID:AGAP005687 Length:297 Species:Anopheles gambiae


Alignment Length:324 Identity:88/324 - (27%)
Similarity:136/324 - (41%) Gaps:55/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKE 112
            :|||             .|.:|...::|.|:...:..:.....:|.....||..:|.|.:|...:
Mosquito    16 VGAE-------------QIDIDWSKVRPVEEFDHYWARLPPELQVYRNDTSTDRVVNGQEALPGQ 67

  Fly   113 FPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGE 177
            ||:...:..:.|:.:..     |||||:...|:||||||:....:       ...|....: :|.
Mosquito    68 FPYQVALLLNFPDGTAL-----CGGSVLTRNFILTAAHCVSATST-------TLVSGGIAI-MGA 119

  Fly   178 LDYNSTTDDALVQDFRVVNYVV--HPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDS 240
              :|.|..:...|..|..:..:  ||.||    :...:||:||:.|:....|...|..:.||  :
Mosquito   120 --HNRTAMELSQQRIRFTSTGIRRHPEYD----DTSLRNDVALILLNSPMTFTSRVKPISLP--A 176

  Fly   241 GNDVQQV-----TAAGWGFTADG--VKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFC---AGS 295
            ..|.:|.     |.:|:|.::|.  ..||.|...:....|...|.....|::......|   .|.
Mosquito   177 RTDTRQFEGFTGTVSGFGRSSDASPYPSSILRFTSNPIMSKAECIVSWGFALAQSQNVCLKPTGG 241

  Fly   296 MSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKVHLYTDWIESIVW 358
            .||    ||||||||:.|...  ..|:  ||.||:|...| :.|.||||.:|..:..||...:|
Mosquito   242 RSS----CNGDSGGPLTVNSG--GVLQ--IGTVSFGSSYGCASGWPSVYARVSYFLSWINENIW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/266 (29%)
Tryp_SPc 102..353 CDD:214473 75/263 (29%)
AgaP_AGAP005687XP_556332.3 Tryp_SPc 56..292 CDD:214473 75/264 (28%)
Tryp_SPc 57..295 CDD:238113 77/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.