DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005689

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_556335.3 Gene:AgaP_AGAP005689 / 3290022 VectorBaseID:AGAP005689 Length:300 Species:Anopheles gambiae


Alignment Length:312 Identity:92/312 - (29%)
Similarity:135/312 - (43%) Gaps:65/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IPLDHQNLKPAE------QTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPF-MALIGTHR 123
            |.:|...::|.|      :..|.|.|.  |.|...:.:    |..|.:|:..:||| :|||....
Mosquito    20 IDIDWSTVRPIEEFDHYWERLPAELQV--YREKLPSHR----ITNGQEATPGQFPFQIALISEFA 78

  Fly   124 PNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDAL 188
            ..      |..|||||:...|:||||||:.:..|..        :...|..:|.  :|....::.
Mosquito    79 SG------NGLCGGSVLTRNFILTAAHCVVSGASTL--------ASGGVAIMGA--HNRNIQEST 127

  Fly   189 VQDFRVVNYVV--HPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQV---- 247
            .|..|.....:  ||.|.:..    .:||||.|.|:....|...:..:.||..|  |.:|.    
Mosquito   128 QQRIRFATSGIRRHPSYSSST----LRNDIATVRLNSPMTFTTRIQPIRLPGRS--DTRQFGGFT 186

  Fly   248 -TAAGWGFTADGVKSSHLLKVNLQRF------SDEVCQKRLRFSIDTRTQFC---AGSMSSQADT 302
             |.:|:|.|:|...::..    :.||      ::..|..|...:: .....|   ||..||    
Mosquito   187 GTVSGFGRTSDASSATSA----VVRFTTNPVMTNTDCIARWGSTV-VNQHVCLSGAGGRSS---- 242

  Fly   303 CNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKVHLYTDWI 353
            ||||||||:.||..    ....||:||:|.|.| :.|:||||.:|..:.|||
Mosquito   243 CNGDSGGPLTVQSG----GTMQIGVVSFGSVNGCAIGMPSVYARVTFFLDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/270 (31%)
Tryp_SPc 102..353 CDD:214473 81/268 (30%)
AgaP_AGAP005689XP_556335.3 Tryp_SPc 55..290 CDD:214473 81/273 (30%)
Tryp_SPc 56..290 CDD:238113 81/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.