DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005665

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_556314.2 Gene:AgaP_AGAP005665 / 3290017 VectorBaseID:AGAP005665 Length:300 Species:Anopheles gambiae


Alignment Length:309 Identity:83/309 - (26%)
Similarity:133/309 - (43%) Gaps:54/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSD 130
            |.:|...::|.|:...:..:.....:|......:..||.|.:|:..:||:...:.::.|..:.. 
Mosquito    19 IDIDWSQVRPIEEFDHYWARLPAELQVYRTKLPSHRIVNGQEATPGQFPYQIALLSNFPTGTGL- 82

  Fly   131 INWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLG--------ELDYNSTTDDA 187
                |||||:...::||||||:.:..|              .:.||        ..|....:...
Mosquito    83 ----CGGSVLTNNYILTAAHCVISGAS--------------TLALGGTAIIGAHNRDVAEPSQQR 129

  Fly   188 LVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQV----- 247
            :.  |.......||||...:    .:||||:|.|:....|.|.:....||..|  |.:|.     
Mosquito   130 IA--FSTAGIRAHPGYTLTN----IRNDIAVVRLNSPITFTDRIQPARLPARS--DTRQFGGFTG 186

  Fly   248 TAAGWGFTADG--VKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFC---AGSMSSQADTCNGDS 307
            |.:|:|.|:|.  ..||.::.......::..|..:....:......|   ||..||    |||||
Mosquito   187 TVSGFGRTSDASQATSSVVMFTTNPVLTNADCIAQWNAVVIEPQNVCLSGAGGRSS----CNGDS 247

  Fly   308 GGPIFVQHPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKVHLYTDWIES 355
            |||:.||..  ..|:  :|:||:|...| :.|:||||.:|..:.|:||:
Mosquito   248 GGPLAVQDG--GSLQ--VGVVSFGSAAGCAIGMPSVYARVSFFLDFIEA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/273 (29%)
Tryp_SPc 102..353 CDD:214473 76/269 (28%)
AgaP_AGAP005665XP_556314.2 Tryp_SPc 54..290 CDD:214473 76/270 (28%)
Tryp_SPc 55..293 CDD:238113 78/273 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.