DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005642

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_556287.3 Gene:AgaP_AGAP005642 / 3290013 VectorBaseID:AGAP005642 Length:313 Species:Anopheles gambiae


Alignment Length:277 Identity:69/277 - (24%)
Similarity:109/277 - (39%) Gaps:69/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWD---CGGSVVHPKFVLTAAHCLETDESKAERLD 163
            ||||:.|:..:.|:...|        .||:...   |||.::...|||||..|:|.....     
Mosquito    70 IVGGSIATAGQIPYQVAI--------LSDLEAGQALCGGVLLSNNFVLTAGVCVENTSGG----- 121

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQG----FKNDIALVELDRK 224
                    ||.||.|:..:..:...|:       :.....|....|:.    |:|:||.:.|...
Mosquito   122 --------VVVLGALNLQNEAEAGQVR-------ITFAAGDVRLHEEFLAVIFRNNIAAIRLSEP 171

  Fly   225 AEFNDHVAAVCLPPDSGNDV---QQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSID 286
            ..|:|.:..|.:|..:....   ...|.:|:|.|:|...|          |||.:  :.:|..|.
Mosquito   172 VSFSDRIQPVRIPAAADGRTFAGALATVSGFGRTSDSSTS----------FSDVL--RYVRNPIM 224

  Fly   287 TRT--------------QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQ 337
            |..              :.|...|.::| .|:||.|||:.|.......|   :|:.|:|.|.|.:
Mosquito   225 TNADCFATAWGGLIDGQKMCLHYMEARA-PCDGDVGGPMTVADGGSTLL---VGLYSFGSVLGCE 285

  Fly   338 G-LPSVYTKVHLYTDWI 353
            . .|:|:.::..|..||
Mosquito   286 SDWPAVFVRITFYRQWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 69/277 (25%)
Tryp_SPc 102..353 CDD:214473 67/275 (24%)
AgaP_AGAP005642XP_556287.3 Tryp_SPc 69..302 CDD:214473 67/275 (24%)
Tryp_SPc 70..302 CDD:238113 67/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.