DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Hayan

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:301 Identity:88/301 - (29%)
Similarity:139/301 - (46%) Gaps:49/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EQTRPFEKQCKQYNEVRSACQS-TPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVV 140
            |:.||....|:   ::||..:. |..|:.|.:.....:|.||.|..:    |.....:.||||::
  Fly   362 EKERPSVAACE---KIRSGGKPLTVHILDGERVDRGVYPHMAAIAYN----SFGSAAFRCGGSLI 419

  Fly   141 HPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDT 205
            ..:||||||||:.:|:|          :|.| ||||.|  |....:...||..|::..:||.|..
  Fly   420 ASRFVLTAAHCVNSDDS----------TPSF-VRLGAL--NIENPEPGYQDINVIDVQIHPDYSG 471

  Fly   206 EDEEQGFKNDIALVELDRKAEFNDHVAAVCL------PPDSGNDVQQVTAAGWGF--TADGVKSS 262
            ..:..    |||:::|...|:.:|.:...||      ||.:    .:...||||.  ..:...|.
  Fly   472 SSKYY----DIAILQLAEDAKESDVIRPACLYTDRSDPPAN----YKYFVAGWGVMNVTNRAVSK 528

  Fly   263 HLLKVNLQRFSDEVC----------QKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPL 317
            .||:..|.....:.|          .:.||..: ..:|.||...:.:.|.|.||||||:.::...
  Fly   529 ILLRAALDLVPADECNASFAEQPSANRTLRRGV-IASQLCAADKNQRKDACQGDSGGPLILEIDD 592

  Fly   318 YPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358
            ......::|::|.|..|.:: .|.:||:|..:.|:||.|||
  Fly   593 VDGTYSIVGVISSGFGCATK-TPGLYTRVSSFLDYIEGIVW 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/271 (29%)
Tryp_SPc 102..353 CDD:214473 76/268 (28%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 76/269 (28%)
Tryp_SPc 385..630 CDD:238113 78/271 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.