DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG4653

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:222 Identity:58/222 - (26%)
Similarity:100/222 - (45%) Gaps:25/222 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVV 199
            |||:::..|::||||||:.....:     .::.:..:.||:|.:  ...|...||...::   ::
  Fly    50 CGGALIREKWILTAAHCVSLGGGQ-----QSYPAKSYNVRVGSI--QRLTGGQLVPLSKI---II 104

  Fly   200 HPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHL 264
            |..|.:.|...  .||:||:||:.....|.:...:.|..:......|:..:|||.:......||:
  Fly   105 HTNYSSSDAVG--SNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHV 167

  Fly   265 LKV-NLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQ-ADTCNGDSGGPIFVQHPLYPCLKQVIGI 327
            |:| ..|..|...||..|  .:......|...:... |..|:||:|.|....:       |::||
  Fly   168 LQVATRQSLSASDCQTEL--YLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNN-------QLVGI 223

  Fly   328 VSYGLV-CGSQGLPSVYTKVHLYTDWI 353
            .::.:. |||: .|..|..|..:.:||
  Fly   224 AAFFVSGCGSE-QPDGYVDVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 58/222 (26%)
Tryp_SPc 102..353 CDD:214473 56/220 (25%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 58/222 (26%)
Tryp_SPc 30..249 CDD:214473 56/220 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.