DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and sphe

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:266 Identity:68/266 - (25%)
Similarity:108/266 - (40%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAE 160
            |.:...|:||..|......|.|.:        :.|....||||::....:||.|||:..|...  
  Fly    20 CHAQGRIMGGEDADATATTFTASL--------RVDNAHVCGGSILSQTKILTTAHCVHRDGKL-- 74

  Fly   161 RLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKA 225
                 .|:.:...|:|     ||...|..:...|.:..|||.|      ....|::|::.|..:.
  Fly    75 -----IDASRLACRVG-----STNQYAGGKIVNVESVAVHPDY------YNLNNNLAVITLSSEL 123

  Fly   226 EFNDHVAAV-------CLPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRF 283
            .:.|.:.|:       .||.:.    .:|..||||.|:||..|..:.:::|:...:..|..  .:
  Fly   124 TYTDRITAIPLVASGEALPAEG----SEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLD--AY 182

  Fly   284 SIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHL 348
            |......||......:. ||:||.||.....:.|......|:|      .|||: .|.|:.::..
  Fly   183 SDHDEQSFCLAHELKEG-TCHGDGGGGAIYGNTLIGLTNFVVG------ACGSR-YPDVFVRLSS 239

  Fly   349 YTDWIE 354
            |.|||:
  Fly   240 YADWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 67/260 (26%)
Tryp_SPc 102..353 CDD:214473 65/257 (25%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/244 (25%)
Tryp_SPc 42..244 CDD:214473 59/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.