DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG9676

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:263 Identity:75/263 - (28%)
Similarity:112/263 - (42%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PFIVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAER 161
            |.|||||||...:||....:   |:|           .||||::...:|:|||||::...:.|..
  Fly    26 PRIVGGTKAREGQFPHQISLRRRGSH-----------TCGGSIISKDYVVTAAHCVKQGNNVAPA 79

  Fly   162 LDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAE 226
            .:....:...::..|.:            ...|....|||.|::..      :|:|::.|.....
  Fly    80 NELEIQAGSLLLSSGGV------------RVPVATVTVHPNYNSNG------HDVAVLRLRNSLT 126

  Fly   227 FNDHVAAVCL----PPDSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSID 286
            ||.::||:.|    ||   ||. .|..:||| .:..|..|:.||.|.::..|.|.|||.....:.
  Fly   127 FNSNIAAIKLATEDPP---NDA-TVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLP 187

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGL-VCGSQGLPSVYTKVHLYT 350
            ..|..........|  |.||||||...|..|       :|:.|:.: .|| :..|..|.:|....
  Fly   188 ETTMCLLHPKDKGA--CYGDSGGPATYQGKL-------VGLASFVIGGCG-RAAPDGYERVSKLR 242

  Fly   351 DWI 353
            :||
  Fly   243 NWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/261 (28%)
Tryp_SPc 102..353 CDD:214473 72/259 (28%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 72/260 (28%)
Tryp_SPc 28..248 CDD:238113 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.