DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG31220

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:365 Identity:103/365 - (28%)
Similarity:157/365 - (43%) Gaps:75/365 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ECKELTPSDCPVIFYN----------------QHLIGAEVKYCDEFNDI-VCCPIPLDHQNLKPA 76
            ||..|  .||..|:||                ..:.|..|:....:..| :|||        |||
  Fly    32 ECIRL--KDCRPIYYNVRRNRLSGSAKVNISQTRMCGVSVRDRKRYKRIYICCP--------KPA 86

  Fly    77 EQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWD------C 135
             .|.|....|       ...|:|..::|||:.:..|:|::|::    ..:::|..|.|      |
  Fly    87 -NTLPSYPDC-------GKPQTTNRVIGGTEPNLNEYPWLAML----LYRNRSAFNPDRELVPSC 139

  Fly   136 GGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVH 200
            |||:::.::|||||||:.....:.:|           ||||| ...|...|.:.:..|:|....|
  Fly   140 GGSLINTRYVLTAAHCVTDTVLQIQR-----------VRLGE-HTTSHNPDCISRGARIVCAPTH 192

  Fly   201 PGYDTED---------EEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQ--QVTAAGWGF 254
            ...|.|.         ....|:||||||.|.....:......:|: .|....:.  ::..||||.
  Fly   193 LDIDVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICV-LDYPRSLMKFKMYVAGWGK 256

  Fly   255 TADGVKSSHLLK---VNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIF-VQH 315
            |......|.:||   |.::: .:|..:|........|.|.|||.:.::. ||:||||.|:. ...
  Fly   257 TGMFDTGSKVLKHAAVKVRK-PEECSEKYAHRHFGPRFQICAGGLDNRG-TCDGDSGSPLMGTSG 319

  Fly   316 PLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
            ..|..:..:.||.|||..||:.|.|||:|:...:..||.:
  Fly   320 RSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFYKWIRA 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/275 (29%)
Tryp_SPc 102..353 CDD:214473 79/271 (29%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 79/272 (29%)
Tryp_SPc 104..360 CDD:238113 81/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.