DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and plg

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_958880.2 Gene:plg / 322691 ZFINID:ZDB-GENE-030131-1411 Length:818 Species:Danio rerio


Alignment Length:396 Identity:110/396 - (27%)
Similarity:161/396 - (40%) Gaps:126/396 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNGTG--------------EC---KELTPSDCPVIFYNQHLI---------GAEVKYC----DE 57
            |.||.|              .|   :.:||        :||..         |.|...|    .:
Zfish   491 CKNGNGAEYRGSTSMTVMGVTCQAWRSMTP--------HQHASFTPETHPDKGLESNQCRNPDSD 547

  Fly    58 FNDIVC-----------CPIPLDHQNLK---PAEQTRPFEKQCKQYNEVRSACQSTPF--IVGGT 106
            .|...|           |.|| |.::||   ||  |:|  |:|              |  ||||.
Zfish   548 VNGPWCYTTDPSKKWDYCQIP-DCESLKCGQPA--TKP--KRC--------------FGRIVGGC 593

  Fly   107 KASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPK- 170
            .:....:|:...:      :::..|:: |||:::.|::|:|||||||..           |||. 
Zfish   594 VSKPHSWPWQISL------RTRGKIHF-CGGTLIDPQWVVTAAHCLERS-----------DSPSA 640

  Fly   171 FVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVC 235
            :.:.||  .:.....::..|:..|...:..|.          ..||||::|||.|..||.|:.||
Zfish   641 YKIMLG--IHTERATESSKQERDVTKIIKGPA----------GTDIALLKLDRPALINDKVSPVC 693

  Fly   236 LPPDS----GNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRT---QFCA 293
            ||...    .|....||  |||.|.|.....:|.:.......::|| .|..| ::.|.   :.||
Zfish   694 LPEKDYIVPSNTECYVT--GWGETQDTGGEGYLKETGFPVIENKVC-NRPSF-LNGRVKDHEMCA 754

  Fly   294 GSMSSQADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            |::....|:|.||||||:.       |..|    :.|:.|:||.|.:...|.|||:|..:.||||
Zfish   755 GNIEGGNDSCQGDSGGPLV-------CYAQNTFVLQGVTSWGLGCANAMKPGVYTRVSKFVDWIE 812

  Fly   355 SIVWGN 360
            ..:..|
Zfish   813 RSIKEN 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/265 (31%)
Tryp_SPc 102..353 CDD:214473 79/262 (30%)
plgNP_958880.2 PAN_AP_HGF 31..104 CDD:238532
KR 109..190 CDD:214527
KR 190..270 CDD:214527
KR 281..361 CDD:214527
Kringle 376..453 CDD:306546
KR 490..572 CDD:214527 18/89 (20%)
Tryp_SPc 589..813 CDD:238113 81/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.