DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and prss59.1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:262 Identity:81/262 - (30%)
Similarity:117/262 - (44%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI--GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            ||||.:......|:.|.:  |.|           .||||:|...:|::||||.   :|:.|    
Zfish    21 IVGGYECQPNSQPWQASLNSGYH-----------FCGGSLVSEYWVVSAAHCY---KSRVE---- 67

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
                    |||||  :|...::...|.......:.:|.||:.|    ..:||.|::|.:.|..|.
Zfish    68 --------VRLGE--HNIVINEGTEQFITSEKVIRNPNYDSWD----LDSDIMLIKLSKPATLNK 118

  Fly   230 HVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQFCA 293
            :|..|.||.....|......:|||.|......|:.|: :.:...||..|.......| |.|.|||
Zfish   119 YVQPVALPNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCNNSYPGMI-TDTMFCA 182

  Fly   294 GSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358
            |.:....|:|.||||||:.       |..::.||||:|..|..:..|.||.||.:::.||...:.
Zfish   183 GYLEGGKDSCQGDSGGPVV-------CNGELHGIVSWGYGCAEKNHPGVYGKVCMFSQWIADTMR 240

  Fly   359 GN 360
            .|
Zfish   241 NN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/256 (31%)
Tryp_SPc 102..353 CDD:214473 78/253 (31%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 78/253 (31%)
Tryp_SPc 21..238 CDD:238113 80/256 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.