DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:269 Identity:80/269 - (29%)
Similarity:120/269 - (44%) Gaps:56/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            |.||:.|...|:|:.|.:   |.|.           ||.|::..:|:||||||.:          
Mouse   185 ITGGSTAHKGEWPWQASLRVNGKHY-----------CGASLIGERFLLTAAHCFQ---------- 228

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQG-FKNDIALVELDRKAEF 227
             ..::||.:.    :.:.:....|.:| ..|...::|     ||..:| ..:|:|:::|..|..|
Mouse   229 -GTNNPKNLT----VSFGTRVTPAYMQ-HSVQEIIIH-----EDYVKGEHHDDVAVIKLTEKVSF 282

  Fly   228 NDHVAAVCL-------PPDSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFS 284
            |:.|..|||       ||..|     |...||| |:.:|.....|.|.:::......|.....:.
Mouse   283 NNDVHRVCLPESTQIFPPGEG-----VVVTGWGSFSYNGKSPLLLQKASIKIIDTNTCNSEEAYG 342

  Fly   285 ---IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKV 346
               :|  |..|||.:....|.|.||||||:.  ||....:..::||||:|..||....|.||.:|
Mouse   343 GRIVD--TMLCAGYLEGSIDACQGDSGGPLV--HPNSRDIWYLVGIVSWGHECGRVNKPGVYMRV 403

  Fly   347 HLYTDWIES 355
            ..|.:||.|
Mouse   404 TSYRNWIAS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/269 (30%)
Tryp_SPc 102..353 CDD:214473 77/265 (29%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699
Tryp_SPc 184..410 CDD:214473 77/265 (29%)
Tryp_SPc 185..413 CDD:238113 80/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.