DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG31681

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:243 Identity:70/243 - (28%)
Similarity:99/243 - (40%) Gaps:57/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGGSVVHPKFVLTAAHCLE----TDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVV 195
            |||.:...:.:|||||||.    ||.|               ||.|. .|.|.....|    :|:
  Fly    54 CGGVIYSDRAILTAAHCLSNVTVTDLS---------------VRAGS-SYWSKGGQVL----KVL 98

  Fly   196 NYVVHPGYDTEDEEQGFKN--DIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADG 258
            ..:.||.|..:     ..|  |||::.|:........|..:.|...:......|..:|||:|.: 
  Fly    99 KTIAHPKYVPK-----LYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRE- 157

  Fly   259 VKSSHLLKV-------NLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQ-- 314
             .||.|..:       .|.|.......|.:..:||   ..||.  ..:.|||.||||||:...  
  Fly   158 -NSSFLWPILQGVHVAILNRTDCLKAYKHVNITID---MICAD--GQRWDTCQGDSGGPLIETTK 216

  Fly   315 --HPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWGN 360
              |      :|:||:||:|..||:.  |.||..:..:.:||:..|..|
  Fly   217 GGH------RQLIGMVSWGDGCGTN--PGVYEDIAFFHNWIKYTVKKN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 68/237 (29%)
Tryp_SPc 102..353 CDD:214473 66/234 (28%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 66/234 (28%)
Tryp_SPc 29..250 CDD:238113 67/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.