DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG31269

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:267 Identity:76/267 - (28%)
Similarity:110/267 - (41%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPF----MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERL 162
            |:||..|.....|:    ..:.|.|           .|||::::..||||||||:|         
  Fly    38 IIGGQAAEDGFAPYQISLQGISGAH-----------SCGGAIINETFVLTAAHCVE--------- 82

  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227
              |...|..||..|...||.......::...     :|..||..:    ..|||||:||.....:
  Fly    83 --NAFIPWLVVVTGTNKYNQPGGRYFLKAIH-----IHCNYDNPE----MHNDIALLELVEPIAW 136

  Fly   228 NDHVAAVCLP--PDSGNDVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRT 289
            ::....:.||  |....|  :|...|||.|. .|.....|..:.||......|:..|....|...
  Fly   137 DERTQPIPLPLVPMQPGD--EVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDV 199

  Fly   290 -QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
             ..|..|...:. .|:||||||:.....|       :|:|::|..|.: |:|.|:..|:.|.|||
  Fly   200 GHICTFSRLGEG-ACHGDSGGPLVSNGYL-------VGLVNWGWPCAT-GVPDVHASVYFYRDWI 255

  Fly   354 ESIVWGN 360
            .:::.||
  Fly   256 RNVMSGN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/261 (28%)
Tryp_SPc 102..353 CDD:214473 72/258 (28%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/258 (28%)
Tryp_SPc 38..258 CDD:238113 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.