DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG31267

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:117/266 - (43%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI----GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERL 162
            ||||.::.....|::..:    |.|           .|.||::|.::|:|||.||.         
  Fly    45 IVGGEESDVLAAPYLVSLQNAYGNH-----------FCAGSIIHDQWVITAASCLA--------- 89

  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227
                ...|..|::....||....:..:  :.|.:.|:|..:|:    ..:.|||||::.....::
  Fly    90 ----GLRKNNVQVVTTTYNHWGSEGWI--YSVEDIVMHCNFDS----PMYHNDIALIKTHALFDY 144

  Fly   228 NDHVAAVCLPP-DSGNDVQQVTAAGWGFTADGVKSS-HLLKVNLQRFSDEVCQKRLRFSIDTRT- 289
            :|....:.:.| :...|.:.:|..|:|.|..|...| .|.::::...:.|.|......:.|... 
  Fly   145 DDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVG 209

  Fly   290 QFCA-GSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ..|| |.:.  |..|:||:||||....      .:::|:.::|:.|| .|.|.|:.::..|..||
  Fly   210 HLCAVGKVG--AGACHGDTGGPIVDSR------GRLVGVGNWGVPCG-YGFPDVFARISFYYSWI 265

  Fly   354 ESIVWG 359
            .|.:.|
  Fly   266 ISTING 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 64/261 (25%)
Tryp_SPc 102..353 CDD:214473 62/258 (24%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 62/258 (24%)
Tryp_SPc 45..268 CDD:238113 64/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.