DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG31205

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:315 Identity:77/315 - (24%)
Similarity:119/315 - (37%) Gaps:98/315 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LKPAEQTRPFEKQC-----KQYNEVRSACQST--PF---IVGGTKASGKEFPFMALIGTHRPNKS 127
            |.|..|.....::|     ||||......:.|  |:   |||.||....     .|:        
  Fly    16 LHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSN-----TLL-------- 67

  Fly   128 KSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDF 192
                   |.|.::..:.|:|||||:..|||                   |..|.....|:...:.
  Fly    68 -------CTGILIDSRRVVTAAHCVSKDES-------------------ESIYGVVFGDSDSSNI 106

  Fly   193 RVVNYV-VHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP------PDSGNDVQQVTAA 250
            .:|:.| |||.|    ..:.|:||:|::||.::..|:|.|..:|||      |.|.....::..|
  Fly   107 NLVSAVTVHPDY----SPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVA 167

  Fly   251 GW-GFTADGVKSS-----HLLKVNLQRFSDEVC-QKRLRFSID-----TRTQFCAGSMSSQADTC 303
            |. |.:.|...|:     ..:|:...:...:.| :|:.||..:     |.....:||..::|   
  Fly   168 GLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALTEA--- 229

  Fly   304 NGDSGGPIFVQHPLYPCLKQ--VIGIVSYGLVCGS---QGLPSVYTKVHLYTDWI 353
               ||.|           :|  ::||...|.....   ||    |..:..:.|||
  Fly   230 ---SGTP-----------RQFHLLGIAVAGFFSSDLDHQG----YLNIRPHLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 67/276 (24%)
Tryp_SPc 102..353 CDD:214473 65/274 (24%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 42/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.