DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG32260

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:130/272 - (47%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            :|||.:|....:|::|.:|....| :::.:.:.||||::|.::|:|:|||:              
  Fly   328 VVGGMEARKGAYPWIAALGYFEEN-NRNALKFLCGGSLIHSRYVITSAHCI-------------- 377

  Fly   167 DSPKF-VVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDH 230
             :|.. :||||..|.:...:.. ..|.|:...|||..:|.    ....|||||:||:.......:
  Fly   378 -NPMLTLVRLGAHDLSQPAESG-AMDLRIRRTVVHEHFDL----NSISNDIALIELNVVGALPGN 436

  Fly   231 VAAVCLPPDSGNDVQQ------VTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTR 288
            ::.:|| |::...:||      ...||||... .||.|..|....:...|...|::..: ||...
  Fly   437 ISPICL-PEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYK-SIFQF 499

  Fly   289 TQF-----CAGSMSSQADTCNGDSGGPIFVQHPLYPCLK------QVIGIVSYGLVCGSQGLPSV 342
            .||     |||  ||..|.|.||||||:     :.|.|:      .::|:||:|..|.....|.|
  Fly   500 VQFSDKVLCAG--SSSVDACQGDSGGPL-----MMPQLEGNVYRFYLLGLVSFGYECARPNFPGV 557

  Fly   343 YTKVHLYTDWIE 354
            ||:|..|..||:
  Fly   558 YTRVASYVPWIK 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/272 (31%)
Tryp_SPc 102..353 CDD:214473 82/269 (30%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 82/269 (30%)
Tryp_SPc 328..571 CDD:238113 84/272 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.