DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss9

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:360 Identity:97/360 - (26%)
Similarity:150/360 - (41%) Gaps:68/360 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIASVSVVTEYCDNGTGEC------KELTPSDCPVIFY---NQHLIGAEVKYCDEFNDIVCCPI 66
            |.:|:...:|..  ..||.|      ::|....||...:   |...:..|...||   |.|.|..
  Rat   159 LSLAAYGTITSV--ELTGRCEGPVTERDLKSGHCPGNAFSCQNSQCVSKENPECD---DRVDCSD 218

  Fly    67 PLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDI 131
            ..|             |.||.  ...:.|.:|...||||.:|:..|||:...:   |.|....  
  Rat   219 GSD-------------EAQCD--CGWQPAWRSAGRIVGGAEAAPGEFPWQVSL---RENHEHF-- 263

  Fly   132 NWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVN 196
               ||.:::..:::::||||..      |..||    .::..:.|.:..:.:  :|.....||:.
  Rat   264 ---CGATIIGARWLVSAAHCFN------EFQDP----AQWAAQAGSVHLSGS--EASAVRARVLR 313

  Fly   197 YVVHPGY--DTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDV----QQVTAAGWGFT 255
            ...||.|  ||.|      .|:|::||.|...|..:|...|||  :...|    ::...:|||:.
  Rat   314 IAKHPAYNADTAD------FDVAVLELARPLPFGRYVQPACLP--AATHVFPPRKKCLISGWGYL 370

  Fly   256 ADG--VKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLY 318
            .:.  ||...|.|..::.....:|......|:..| ..|||.:..:.|:|.||||||:..:.|..
  Rat   371 KEDFLVKPEVLQKATVELLDQNLCSSLYGHSLTDR-MVCAGYLDGKVDSCQGDSGGPLVCEEPSG 434

  Fly   319 PCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ...  :.|:||:|:.|.....|.|||:|....|||
  Rat   435 RFF--LAGVVSWGIGCAEARRPGVYTRVTRLRDWI 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/260 (29%)
Tryp_SPc 102..353 CDD:214473 73/258 (28%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.