DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss3

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:275 Identity:81/275 - (29%)
Similarity:128/275 - (46%) Gaps:50/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SACQS----TPFIVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHC 151
            |||..    :|.||||..:|..::|:...:   |.|.           |||||:.|.:::|||||
  Rat   205 SACGMRTGYSPRIVGGNVSSLTQWPWQVSLQFQGYHL-----------CGGSVITPLWIVTAAHC 258

  Fly   152 LETDESKAERLDPNFD--SPK-FVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK 213
            :             :|  .|| :.|::|.:    :..|:.|....|...:.|..|    :.:...
  Rat   259 V-------------YDLYHPKSWTVQVGLV----SLMDSPVPSHLVEKIIYHSKY----KPKRLG 302

  Fly   214 NDIALVELDRKAEFNDHVAAVCLPPDSGN--DVQQVTAAGWGFTADGV--KSSHLLKVNLQRFSD 274
            |||||::|.....|::.:..:|||....|  |.:....:|||.|.||.  .|..|....:...|:
  Rat   303 NDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISN 367

  Fly   275 EVCQKR-LRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQG 338
            ::|..| :...|.:.:..|||.:....|:|.||||||:..|...   |.:::|..|:|:.|....
  Rat   368 KICNHRDVYGGIISPSMLCAGYLKGGVDSCQGDSGGPLVCQERR---LWKLVGATSFGIGCAEVN 429

  Fly   339 LPSVYTKVHLYTDWI 353
            .|.|||::..:.|||
  Rat   430 KPGVYTRITSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/263 (29%)
Tryp_SPc 102..353 CDD:214473 75/261 (29%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 3/5 (60%)
Tryp_SPc 216..444 CDD:214473 75/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.