DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:327 Identity:87/327 - (26%)
Similarity:145/327 - (44%) Gaps:61/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QHLIGAEVKYCDEFNDIVCCPIPLDHQN--LKPAEQTRP--FEKQCKQYNEVRSACQSTPFIVGG 105
            ::::..::||...       |..:|.::  :|...:|..  :...|......:|..|::..||||
  Rat   159 EYVLREKLKYATG-------PPKVDPESVEIKKINKTESDNYLNHCCGTRRNKSTAQTSVRIVGG 216

  Fly   106 TKASGKEFPFMALIGTHRPNKSKSDINWD----CGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |.|...|:|:            :|.:.||    ||.:::...::::||||..|.:      ||:.
  Rat   217 TSAEEGEWPW------------QSSLQWDGSHRCGATLISNTWLVSAAHCFRTHK------DPSR 263

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
            .:..|...|        ....|....|.:  :||..|:....:.    |||||||.|.....:.|
  Rat   264 WTASFGATL--------QPPKLTTGIRRI--IVHEKYNYPSHDY----DIALVELSRPVPCTNAV 314

  Fly   232 AAVCLPPDSGNDV---QQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFS-IDTRTQF 291
            ..||| ||:.::.   |::...|:| ...||...::|.:|.:.....:.|.:...:: ..|....
  Rat   315 HKVCL-PDANHEFQPGQRMFVTGFGALRNDGFAQNYLRQVQVDYIDTQTCNRPQSYNGAITPRML 378

  Fly   292 CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQV---IGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            |||.:..:.|.|.||||||:     :.|.::.|   .|:||:|..||....|.|||:|..:.|||
  Rat   379 CAGFLKGEKDACQGDSGGPL-----VTPDVRDVWYLAGVVSWGDECGQPNKPGVYTRVTAFRDWI 438

  Fly   354 ES 355
            .|
  Rat   439 TS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/266 (29%)
Tryp_SPc 102..353 CDD:214473 75/262 (29%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113 3/23 (13%)
Tryp_SPc 213..441 CDD:238113 78/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.