DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss32

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:356 Identity:90/356 - (25%)
Similarity:139/356 - (39%) Gaps:119/356 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LIGAEVKYCDEFN------------DIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQST 99
            |:|:||...|.::            |.||               .||               :::
  Rat    17 LLGSEVLTTDSYSLSTQTGRSSIDLDSVC---------------GRP---------------RAS 51

  Fly   100 PFIVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAER 161
            ..||.|..|...::|:...:   |.|           .||||::...:|||||||...|:..:  
  Rat    52 GRIVSGQNAQLGQWPWQVSVREDGVH-----------VCGGSLISEDWVLTAAHCFNQDQHLS-- 103

  Fly   162 LDPNFDSPKFVVRLGELDYNSTTDDALVQDFR-VVNYVVHPGYDTEDEEQGFKNDIALVELDRKA 225
                    .:.|.||.:  :|..:|...::.| |..|:.:|.|..|:...|   ||||::|....
  Rat   104 --------AYTVLLGTI--SSYPEDNEPRELRAVAQYIKYPSYSAEEHSSG---DIALLQLASPI 155

  Fly   226 EFNDHVAAVCLPPDSGNDVQQVT---AAGWG-----------FTADGVKSSHLLKVNLQRFSDEV 276
            .|||::..||| |..|:.:...|   ..|||           ||        |.::.:.....:.
  Rat   156 SFNDYMLPVCL-PKPGDPLDPGTMCWVTGWGNIATNQPLPPPFT--------LQELQVPLIDAKT 211

  Fly   277 CQKRLRFSIDTRTQ-------FCAGSMSSQADTCNGDSGGP-------IFVQHPLYPCLKQVIGI 327
            |....:.:....|:       .|||.:..:.|.||||||||       :::|          .|:
  Rat   212 CNTYYQENSVPSTEQVILEDMLCAGFVEGKKDACNGDSGGPLVCDVNDVWIQ----------AGV 266

  Fly   328 VSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358
            ||:|..|.....|.|||.|.:|..||::.:|
  Rat   267 VSWGSDCALSNRPGVYTNVSVYISWIQNTMW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/285 (28%)
Tryp_SPc 102..353 CDD:214473 77/282 (27%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 77/283 (27%)
Tryp_SPc 54..295 CDD:238113 79/285 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.