DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and HABP2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:368 Identity:108/368 - (29%)
Similarity:166/368 - (45%) Gaps:55/368 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLIASVSVVTEYCD-NGTGE---CKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDH 70
            |||..:.::..|..: :|.||   |:.....:.|..|..  :...:||:  |:.|:..|    ..
Human   222 LLLQENYNMFMEDAETHGIGEHNFCRNPDADEKPWCFIK--VTNDKVKW--EYCDVSAC----SA 278

  Fly    71 QNLKPAEQTRPFEKQCK-----QYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSD 130
            |::...|:: |.|...|     ...:...|.:....|.||.|::..:.|:.|.:.:..|......
Human   279 QDVAYPEES-PTEPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMP 342

  Fly   131 INWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVV 195
            ....|||:::||.:|||||||.:.   |...|.         |.||:.|...  ::...|.|||.
Human   343 QGHFCGGALIHPCWVLTAAHCTDI---KTRHLK---------VVLGDQDLKK--EEFHEQSFRVE 393

  Fly   196 NYVVHPGYDTEDEEQGFKNDIALVEL----DRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTA 256
            ....:..|:..||..  .|||||::|    ...|..:.:|..||||..|.....:...:|||.|.
Human   394 KIFKYSHYNERDEIP--HNDIALLKLKPVDGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTE 456

  Fly   257 DGVKSSHLLKVNLQRFSDEVCQKRLRFS--IDTRTQFCAGSMSSQA-DTCNGDSGGPIFVQHPLY 318
            .|..|..||...::..::.:|..|..:.  ||. :..|||::.... |||.||||||:       
Human   457 TGKGSRQLLDAKVKLIANTLCNSRQLYDHMIDD-SMICAGNLQKPGQDTCQGDSGGPL------- 513

  Fly   319 PCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            .|.|.    |.||||:||.||.:  |.|||:|..:.:||::.:
Human   514 TCEKDGTYYVYGIVSWGLECGKR--PGVYTQVTKFLNWIKATI 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 87/264 (33%)
Tryp_SPc 102..353 CDD:214473 85/261 (33%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056 15/62 (24%)
Tryp_SPc 314..553 CDD:238113 87/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.