DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss42

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:276 Identity:81/276 - (29%)
Similarity:128/276 - (46%) Gaps:60/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |:||..|...::|:...:.....:.        ||||:::.::|||||||:.:      |:..| 
  Rat    84 IMGGVDAEEGKWPWQVSLRVRHMHV--------CGGSLLNSQWVLTAAHCIHS------RVQYN- 133

  Fly   167 DSPKFVVRLGELD-YNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDH 230
                  |::|:.. |...|  :||  ..:.|..|||.:.|....|   |||||::|.:...|...
  Rat   134 ------VKMGDRSVYRQNT--SLV--IPIQNIFVHPKFSTTTVVQ---NDIALLKLQQPVNFTSS 185

  Fly   231 VAAVCLPPDSGNDVQQVT---AAGWGFTADG---VKSSHLLKVN----LQRFSDEVCQKRLRFSI 285
            :..:|:|..:.: |:..|   ..|||....|   :.:..|.:|:    |....:|:.:|....|:
  Rat   186 IHPICVPTGTFH-VKAGTKCWVTGWGKPDPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSV 249

  Fly   286 D--TRTQFCAGSMSSQADTCNGDSGGPI-------FVQHPLYPCLKQVIGIVSYGLVCGSQGLPS 341
            |  .|...||.....: |.|.||||||:       :||          ||:||:|:.||.:|.|.
  Rat   250 DLVKRGMVCAYKEGGK-DACQGDSGGPLSCEFDNRWVQ----------IGVVSWGIGCGRKGHPG 303

  Fly   342 VYTKVHLYTDWIESIV 357
            |||.|..|..|:.::|
  Rat   304 VYTDVAFYNKWLITVV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/273 (29%)
Tryp_SPc 102..353 CDD:214473 79/270 (29%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 79/269 (29%)
Tryp_SPc 84..315 CDD:238113 79/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.