DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss13

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001121000.1 Gene:Tmprss13 / 300682 RGDID:1310872 Length:539 Species:Rattus norvegicus


Alignment Length:384 Identity:95/384 - (24%)
Similarity:148/384 - (38%) Gaps:93/384 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNGTGECKELTPSD---CPVIFYNQHLI-------GAEVKYC-DEFNDI----VCCPIPLD--H 70
            || |..:||  ..||   |....:::.|:       |..:..| ..:||.    .|..:..|  :
  Rat   183 CD-GVVDCK--MKSDELGCVRFDWDKSLLKVYSGSSGEWLPVCSSSWNDTDSERTCQQLGFDSAY 244

  Fly    71 QNLKPAEQTRPFEKQCKQYNE------VRSACQS----------------TPFIVGGTKASGKEF 113
            :..:.|.:.........:||.      .||.|.|                |..||||...|..::
  Rat   245 RTTEVAHRDVTSSFLLSEYNSTIQESLTRSECPSRRYVSLQCAHCGLRAMTGRIVGGALTSESKW 309

  Fly   114 PFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRL 175
            |:...:   .||           .|||:::..::|||||||.                  ||.|.
  Rat   310 PWQVSLHFGTTH-----------ICGGTLIDAQWVLTAAHCF------------------FVTRE 345

  Fly   176 GELD----YNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCL 236
            ..|:    |..|::...:.:...::.::..|..|::::.   .|||||.|.:....:.|:...||
  Rat   346 KILEGWKVYAGTSNLHQLPEAASISQIIINGNYTDEQDD---YDIALVRLSKPLTLSAHIHPACL 407

  Fly   237 PPDSG----NDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRF-SIDTRTQFCAGSM 296
            |....    |:...:|..|.....|...|..|.:|.:.....:.|...|.: |..|....|||.:
  Rat   408 PLHGQTFGLNETCWITGFGKTKETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDL 472

  Fly   297 SSQADTCNGDSGGPIFVQ--HPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ....|:|.||||||:..:  :..|     :.|:.|:|..||.:..|.|||||.....||
  Rat   473 RGGRDSCQGDSGGPLVCEQNNRWY-----LAGVTSWGTGCGQKNKPGVYTKVTEVLPWI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 72/266 (27%)
Tryp_SPc 102..353 CDD:214473 70/264 (27%)
Tmprss13NP_001121000.1 WWbp <1..69 CDD:304964
SRCR_2 203..292 CDD:292133 14/88 (16%)
SRCR 216..288 CDD:278931 13/71 (18%)
Tryp_SPc 297..526 CDD:214473 70/265 (26%)
Tryp_SPc 298..526 CDD:238113 70/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.