DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and GZMM

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_005308.2 Gene:GZMM / 3004 HGNCID:4712 Length:257 Species:Homo sapiens


Alignment Length:281 Identity:83/281 - (29%)
Similarity:119/281 - (42%) Gaps:80/281 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            |:||.:......|:||.:   |:|.           |||.:||||:||||||||      |:|: 
Human    26 IIGGREVIPHSRPYMASLQRNGSHL-----------CGGVLVHPKWVLTAAHCL------AQRM- 72

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
               ...:.|:.|..||....|       |.:...:.||.|   ......:||:||::||.|.:.:
Human    73 ---AQLRLVLGLHTLDSPGLT-------FHIKAAIQHPRY---KPVPALENDLALLQLDGKVKPS 124

  Fly   229 DHVAAVCLPPDSGNDVQQVTA-------AGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSI 285
            ..:..:.||     ..:||.|       ||||.|..|.:.|.:|: ::||.....:|        
Human   125 RTIRPLALP-----SKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMC-------- 176

  Fly   286 DTRTQFCAGSMSSQ-----ADT-----CNGDSGGPIFVQHPLYPC-----LKQVIGIVSYGLVCG 335
             ..::|..||:|..     ||:     |.||||||:.       |     |.:|:...|  .||.
Human   177 -NNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLV-------CGKGRVLARVLSFSS--RVCT 231

  Fly   336 SQGLPSVYTKVHLYTDWIESI 356
            ....|.|.|.|..|..||..:
Human   232 DIFKPPVATAVAPYVSWIRKV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/279 (30%)
Tryp_SPc 102..353 CDD:214473 81/276 (29%)
GZMMNP_005308.2 Tryp_SPc 26..252 CDD:238113 83/279 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.