DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and GZMK

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:267 Identity:83/267 - (31%)
Similarity:118/267 - (44%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI--GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            |:||.:.|....||||.|  |.|..          |||.::.|::||||||| :...:|.:    
Human    27 IIGGKEVSPHSRPFMASIQYGGHHV----------CGGVLIDPQWVLTAAHC-QYRFTKGQ---- 76

  Fly   165 NFDSPKFVVRLGELDYNSTTDDAL-VQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
               ||..|:....|..|..:...| ::.|...:.|      |.|.:   .|||.||:|...|:.|
Human    77 ---SPTVVLGAHSLSKNEASKQTLEIKKFIPFSRV------TSDPQ---SNDIMLVKLQTAAKLN 129

  Fly   229 DHVAAVCLPPD----SGNDVQQVTAAGWGFT-ADGVKSSHLLK-VNLQRFSDEVCQKRLRFSID- 286
            .||..:.:...    ||.   :....|||.| .|.::.|..|: |.:...|.::|..:..::.| 
Human   130 KHVKMLHIRSKTSLRSGT---KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDP 191

  Fly   287 --TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKV-HL 348
              |:...|||....|.|:|.||||||:.       |......|||.|..||....|.:||.: ..
Human   192 FITKDMVCAGDAKGQKDSCKGDSGGPLI-------CKGVFHAIVSGGHECGVATKPGIYTLLTKK 249

  Fly   349 YTDWIES 355
            |..||:|
Human   250 YQTWIKS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/267 (31%)
Tryp_SPc 102..353 CDD:214473 80/263 (30%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 80/263 (30%)
Tryp_SPc 27..257 CDD:238113 83/267 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.