DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and GZMH

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:258 Identity:75/258 - (29%)
Similarity:108/258 - (41%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            |..|:||.:|.....|:||.:...:....|.     |||.:|...||||||||            
Human    18 TEEIIGGHEAKPHSRPYMAFVQFLQEKSRKR-----CGGILVRKDFVLTAAHC------------ 65

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
               ......|.||.  :|....:...|...|...:.||.|:.::    |.|||.|::|:|||::.
Human    66 ---QGSSINVTLGA--HNIKEQERTQQFIPVKRPIPHPAYNPKN----FSNDIMLLQLERKAKWT 121

  Fly   229 DHVAAVCLPPDSG--NDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQF 291
            ..|..:.||....  ...|..:.||||:.:....::.|.:|.|....|..|::....:....|:.
Human   122 TAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEI 186

  Fly   292 CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            |.|..........||||||:.       |.....||:|||...|:.  |.||.||..:..||:
Human   187 CVGDPKKTQTGFKGDSGGPLV-------CKDVAQGILSYGNKKGTP--PGVYIKVSHFLPWIK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/255 (29%)
Tryp_SPc 102..353 CDD:214473 72/252 (29%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 74/255 (29%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.