DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Gzmk

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:268 Identity:82/268 - (30%)
Similarity:115/268 - (42%) Gaps:57/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            |:||.:......||||.|   |.|           .|||.::||::|||||||.....       
  Rat    26 IIGGREVQPHSRPFMASIQYRGKH-----------ICGGVLIHPQWVLTAAHCYSRGH------- 72

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
                ||..|:....|..|    :.:.|.|.:..::...|:      :...|||.|::|...||.|
  Rat    73 ----SPTVVLGAHSLSKN----EPMKQTFEIKEFIPFSGF------KSGTNDIMLIKLRTAAELN 123

  Fly   229 DHVAAVCLPPDSGNDVQ-----QVTAAGWGFTADGV--KSSHLLKVNLQRFSDEVCQKRLRFS-- 284
            .||..:.|  .|.|.::     |||  |||.|...|  .|..|.:|.:...|.:.|..:..::  
  Rat   124 KHVQLLHL--RSKNYIRDGTKCQVT--GWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHK 184

  Fly   285 -IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKV-H 347
             :.|:...|||....:.|:|.||||||:.       |......:||.|..||....|.|||.: .
  Rat   185 PVITKDMICAGDRRGEKDSCKGDSGGPLI-------CKGVFHALVSGGYKCGISNKPGVYTLLTK 242

  Fly   348 LYTDWIES 355
            .|..||:|
  Rat   243 KYQTWIKS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/268 (31%)
Tryp_SPc 102..353 CDD:214473 79/264 (30%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 79/264 (30%)
Tryp_SPc 26..251 CDD:238113 82/268 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.