DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss15

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:389 Identity:96/389 - (24%)
Similarity:166/389 - (42%) Gaps:83/389 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EYCDNGTGE--CKEL---TPSDCPVIFYNQH---LIGAEVKYCDEFNDIVCCPIPLDHQNLK-PA 76
            ::|.:|:.|  |...   |.|:..::.:|.|   .|.....:..:.::.||..:.|...|.. |.
  Rat   670 QHCSDGSDEAHCVRFLNGTQSNNGLVQFNIHNIWHIACAEPWTTQISNEVCHLLGLGSANSSMPI 734

  Fly    77 EQT--RPFEK---------------QCKQYNEVRSACQST------------PFIVGGTKASGKE 112
            ..|  .||.:               ||.|.:.:...|...            |.||||:......
  Rat   735 LSTGGGPFVRLNEAPNGSLILTPSLQCSQDSLILLQCNHKSCGEKMVTQKVGPKIVGGSDTQAGA 799

  Fly   113 FPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGE 177
            :|::..:    ..:.:|.....||.|:|...::::||||:         ...|.|..::...||.
  Rat   800 WPWVVAL----YYRDRSGDRLLCGASLVSSDWLVSAAHCV---------YRRNLDPTRWTAVLGL 851

  Fly   178 LDYNSTTDDALVQDFRVVN-YVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSG 241
            ...::.|...:|:  |||: .|::|.||...:    .||||::.|:.|..:.|::..:|||.::.
  Rat   852 HMQSNLTSPQVVR--RVVDRIVINPHYDKRRK----VNDIAMMHLEFKVNYTDYIQPICLPEENQ 910

  Fly   242 NDV--QQVTAAGWGF-------TADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMS 297
            ...  :..:.||||:       |.|.:|.:.:..|     |:|.||::|.....|.:..|||...
  Rat   911 TFTPGRMCSIAGWGYNKINAGSTVDVLKEADVPLV-----SNEKCQQQLPEYDITESMLCAGYEE 970

  Fly   298 SQADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            ...|:|.||||||:.       |.:.    ::|:.|:|:.|.....|.||.:|..:.:||.|.:
  Rat   971 GGTDSCQGDSGGPLM-------CQENNRWFLVGVTSFGVQCALPNHPGVYARVSQFIEWIHSFL 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/267 (27%)
Tryp_SPc 102..353 CDD:214473 71/264 (27%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060 3/10 (30%)
Tryp_SPc 789..1025 CDD:238113 73/266 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.