DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss34

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:276 Identity:88/276 - (31%)
Similarity:135/276 - (48%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWD--CGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            ||||...|...||:...:..:....||    |:  ||||::||::|||||||:|..|.:|.    
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSK----WEHICGGSLIHPQWVLTAAHCVELKEMEAS---- 89

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
                 .|.|::|:|  ....:|.|:   :|...:.||.:..:....| ..||||::||.....::
  Rat    90 -----CFRVQVGQL--RLYENDQLM---KVAKIIRHPKFSEKLSAPG-GADIALLKLDSTVVLSE 143

  Fly   230 HVAAVCLPPDSGNDVQQVTA------AGWGFTADGVK----SSHLLKVNLQRFSDEVCQKRLR-- 282
            .|..|.||..|    |::::      |||| ..:|.:    ..||.:|.:....:..|:::.|  
  Rat   144 RVHPVSLPAAS----QRISSKKTWWVAGWG-VIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTY 203

  Fly   283 FSIDTRTQ------FCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPS 341
            .|:|..|:      .||| |..: |:|..|||||:..:   :.|....:|:||:|:.||....|.
  Rat   204 SSLDRTTKIIKDDMLCAG-MEGR-DSCQADSGGPLVCR---WNCSWVQVGVVSWGIGCGLPDFPG 263

  Fly   342 VYTKVHLYTDWIESIV 357
            |||:|..|..||...|
  Rat   264 VYTRVMSYLSWIHGYV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 87/273 (32%)
Tryp_SPc 102..353 CDD:214473 85/270 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 86/271 (32%)
Tryp_SPc 33..275 CDD:214473 85/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.