DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss27

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:280 Identity:81/280 - (28%)
Similarity:108/280 - (38%) Gaps:62/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            :|||..|...|:|:...|   |.|           .||||::.|.:|||||||.....       
  Rat    38 MVGGEDALEGEWPWQVSIQRNGAH-----------FCGGSLIAPTWVLTAAHCFSNTS------- 84

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKN--DIALVELDRKAE 226
               |...:.|.||.|........||....:.|.  .||.|      ||..:  |:|||||.....
  Rat    85 ---DISIYQVLLGALKLQQPGPHALYVPVKRVK--SHPEY------QGMASSADVALVELQVPVT 138

  Fly   227 FNDHVAAVCLPPDS--GNDVQQVTAAGWGFTA--DGVKSSHLL-----------KVNLQRFSDEV 276
            |..::..||||..|  ..........|||..:  |.:.:..:|           |.||....|..
  Rat   139 FTKYILPVCLPDPSVVFKSGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKCNLLYSKDAE 203

  Fly   277 CQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQ 337
            ...:|:...|  ...|||....:.|.|.||||||:.       ||..    ..|::|:|..|..:
  Rat   204 ADIQLKTIKD--DMLCAGFAEGKKDACKGDSGGPLV-------CLVDQSWVQAGVISWGEGCARR 259

  Fly   338 GLPSVYTKVHLYTDWIESIV 357
            ..|.||.:|..:..||..|:
  Rat   260 NRPGVYIRVASHYQWIHQII 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/277 (29%)
Tryp_SPc 102..353 CDD:214473 78/274 (28%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 78/274 (28%)
Tryp_SPc 39..278 CDD:238113 80/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.