DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss30

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:275 Identity:83/275 - (30%)
Similarity:123/275 - (44%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            ||||..|....:|:...:.|.:....       ||||::|..:|||||||.      ...|:.:|
  Rat    31 IVGGQDAPEGRWPWQVSLRTEKEGHI-------CGGSLIHEVWVLTAAHCF------CRPLNSSF 82

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELD---RKAEFN 228
                :.|::|.|..:.|...:.:...|  |..|:|.|..||...|   ||||:.||   :.::| 
  Rat    83 ----YHVKVGGLTLSLTEPHSTLVAVR--NIFVYPTYLWEDASSG---DIALLRLDTPLQPSQF- 137

  Fly   229 DHVAAVCLP----PDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFS----- 284
               :.||||    |.:...|..||  |||.|.:...:|.|.::.:.....|.|::.....     
  Rat   138 ---SPVCLPQAQAPLTPGTVCWVT--GWGATHERELASVLQELAVPLLDSEDCERMYHIGETSLS 197

  Fly   285 ---IDTRTQFCAGSMSSQADTCNGDSGGPI-------FVQHPLYPCLKQVIGIVSYGLVCGSQGL 339
               :......|||.:..|.|:|.||||||:       ::|          :||.|:|:.|.....
  Rat   198 GKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQ----------VGITSWGIGCARPNK 252

  Fly   340 PSVYTKVHLYTDWIE 354
            |.|||:|..|.|||:
  Rat   253 PGVYTRVPDYVDWIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/275 (30%)
Tryp_SPc 102..353 CDD:214473 81/272 (30%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.