DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss3b

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:263 Identity:81/263 - (30%)
Similarity:118/263 - (44%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI--GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            ||||........|:...:  |.|           .||||:::.::|::||||.::          
  Rat    25 IVGGYTCQKNSLPYQVSLNAGYH-----------FCGGSLINSQWVVSAAHCYKS---------- 68

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
                 :..|||||  :|....:...|.......:.||.|:...    |.|||.|::|:..|..|.
  Rat    69 -----RIQVRLGE--HNIDVVEGGEQFIDAAKIIRHPSYNANT----FDNDIMLIKLNSPATLNS 122

  Fly   230 HVAAVCLPPDSGNDVQQVTAAGWGFT-ADGVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQFC 292
            .|:.|.||...|:...:...:|||.| :.|.....||: ::....||..|:......| |...||
  Rat   123 RVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYPGKI-TSNMFC 186

  Fly   293 AGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            .|.:....|:|.||||||:.       |..|:.|:||:|..|..:|.|.|||||..|.:||:..|
  Rat   187 LGFLEGGKDSCQGDSGGPVV-------CNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQTV 244

  Fly   358 WGN 360
            ..|
  Rat   245 AAN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/257 (31%)
Tryp_SPc 102..353 CDD:214473 77/254 (30%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 77/254 (30%)
Tryp_SPc 25..243 CDD:238113 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.