DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG33459

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:277 Identity:86/277 - (31%)
Similarity:122/277 - (44%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CQSTPF---IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDES 157
            |...||   |.||..|.....|:||.:..|        :.:.||||::..:||||||||:     
  Fly    29 CGQIPFRMRIFGGMDAGLVSTPWMAFLHNH--------LQFLCGGSLITSEFVLTAAHCV----- 80

  Fly   158 KAERLDPNFDSPK-FVVRLGELDYNSTTDDA----LVQDFRVVNYVVHPGYDTEDEEQGFKNDIA 217
                    ..:|| ..|||||.|:....|..    ..:::.|.....||.|     ......|||
  Fly    81 --------MPTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSY-----RSIAAYDIA 132

  Fly   218 LVELDRKAEFNDHVAAVCLP-PDSGND-------VQQVTAAGWGFTADGVKSSHLLKVNLQRFSD 274
            |::|::..|:...:..:||. |::.::       |:..|..|||.|.....|..|...||.:...
  Fly   133 LLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDR 197

  Fly   275 EVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPI---FVQHPLYPCLKQVIGIVSYGLVCGS 336
            ..|..|...|:| .|..||||..|.|  |.||||.|:   .|.:..|  :...:||||.| ....
  Fly   198 GTCHDRYGHSVD-HTHICAGSSKSFA--CVGDSGSPLAMKVVHNRRY--IHAQVGIVSRG-PKNC 256

  Fly   337 QGLPSVYTKVHLYTDWI 353
            .|: :|:|.|..:|:||
  Fly   257 DGV-TVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/268 (31%)
Tryp_SPc 102..353 CDD:214473 81/266 (30%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 81/267 (30%)
Tryp_SPc 38..272 CDD:238113 81/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.