DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG33462

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:270 Identity:75/270 - (27%)
Similarity:115/270 - (42%) Gaps:70/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGEL 178
            |:||.:.|.:        .:.|.|::::..||||||||:.             |.....||||| 
  Fly    48 PWMAYLETPK--------GFHCSGTLINHLFVLTAAHCVP-------------DDLLITVRLGE- 90

  Fly   179 DYNSTT----DDALVQD-FRVVNYVV---HPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVC 235
             ||:.|    |:.|.|: |:..|..:   |..|:..|:    .|||.::.|.|:.|:.:|:..:|
  Fly    91 -YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQ----TNDIGMLRLGRRVEYLNHIRPIC 150

  Fly   236 LPPDSGNDVQQ-------VTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCA 293
            :  .:.|..|:       .|...|..||....|..|..:|:.|...|.|.:...::: |..|.||
  Fly   151 I--FASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNM-TFEQICA 212

  Fly   294 GSMSSQADTCNGDSGGP-----------IFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVH 347
            |:..||  .|:.|||.|           .:||          :||.|  .|.|......:...:.
  Fly   213 GNTLSQ--LCSTDSGAPQIRKMWHNGSDRYVQ----------LGIAS--RVKGQCQNSGILMDLL 263

  Fly   348 LYTDWIESIV 357
            .|.|||:.:|
  Fly   264 SYADWIKRVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/267 (28%)
Tryp_SPc 102..353 CDD:214473 72/264 (27%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 74/267 (28%)
Tryp_SPc 48..269 CDD:214473 72/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.