DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tpsg1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:271 Identity:81/271 - (29%)
Similarity:115/271 - (42%) Gaps:62/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            ||||..|....:|:.|.:..|:.:.        ||||::.|::|||||||          ...:.
Mouse    87 IVGGHAAPAGTWPWQASLRLHKVHV--------CGGSLLSPEWVLTAAHC----------FSGSV 133

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
            :|..:.|.||||....:...:.|:  |::.|...||      ..|...|||||:|......:..|
Mouse   134 NSSDYQVHLGELTVTLSPHFSTVK--RIIMYTGSPG------PPGSSGDIALVQLSSPVALSSQV 190

  Fly   232 AAVCLPPDSGN--DVQQVTAAGWGFTADG--VKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFC 292
            ..||||..|.:  ...|....|||:|.:|  :|..:    |||.....|        :|.:|  |
Mouse   191 QPVCLPEASADFYPGMQCWVTGWGYTGEGEPLKPPY----NLQEAKVSV--------VDVKT--C 241

  Fly   293 AGSMSS---------------QADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSV 342
            :.:.:|               ..|.|..|||||:..|   .....|..|:||:|..||....|.|
Mouse   242 SQAYNSPNGSLIQPDMLCARGPGDACQDDSGGPLVCQ---VAGTWQQAGVVSWGEGCGRPDRPGV 303

  Fly   343 YTKVHLYTDWI 353
            |.:|..|.:||
Mouse   304 YARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/271 (30%)
Tryp_SPc 102..353 CDD:214473 79/269 (29%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 81/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.