DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Gzma

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:270 Identity:81/270 - (30%)
Similarity:117/270 - (43%) Gaps:51/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |:||........|:|.|:      |.|.|.  .|.|:::...:|||||||:...:|:        
  Rat    29 IIGGDTVVPHSRPYMVLL------KLKPDS--ICAGALIAKNWVLTAAHCIPGKKSE-------- 77

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
                  |.||.   :|...:...|...|.....:|.:|....|    .|:.|:.|.:||..|.:|
  Rat    78 ------VILGA---HSIKKEPEQQILSVKKAYPYPCFDKHTHE----GDLQLLRLKKKATLNKNV 129

  Fly   232 AAVCLPPDSGNDVQQVT---AAGWG-FTADGVKSSHLLKVNLQRFSDEVC--QKRLRFS-IDTRT 289
            |.:.| |..|:||:..|   .|||| |......|..|.:||:.....::|  :|...|: :....
  Rat   130 AILHL-PKKGDDVKPGTRCHVAGWGRFHNKSPPSDTLREVNITVIDRKICNDEKHYNFNPVIGLN 193

  Fly   290 QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLV--CGSQGLPSVYTKV---HLY 349
            ..|||::....|:|.||||||:.       |.....||.::||.  ||....|.:||.:   || 
  Rat   194 MICAGNLRGGKDSCYGDSGGPLL-------CEGIFRGITAFGLEGRCGDPKGPGIYTLLSDKHL- 250

  Fly   350 TDWIESIVWG 359
             |||.....|
  Rat   251 -DWIRKTAKG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/265 (30%)
Tryp_SPc 102..353 CDD:214473 78/262 (30%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 78/262 (30%)
Tryp_SPc 29..256 CDD:238113 80/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.