DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss5

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:344 Identity:93/344 - (27%)
Similarity:143/344 - (41%) Gaps:63/344 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CPVIFY---NQH----LIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQT---RPFEKQCKQYNEV 92
            |..:.|   .||    |...::....||..:...|..|..:..:|:...   |....:|      
  Rat   138 CQSLGYFRLTQHKAVNLSDIKLNRSQEFAQLSARPGSLVEEAWQPSTNCPSGRIVSLKC------ 196

  Fly    93 RSACQSTPF---IVGGTKASGKEFPFMA--LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCL 152
             |.|.:.|.   ||||...:...:|:.|  ::|:..          .||.||:.|.:|:|||||:
  Rat   197 -SECGARPLASRIVGGQAVASGRWPWQASVMLGSRH----------TCGASVLAPYWVVTAAHCM 250

  Fly   153 ETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIA 217
            .:  .:..||.      .:.|..|.:.:::....   |...|...:.||.|..::.:.    |:|
  Rat   251 YS--FRLSRLS------SWRVHAGLVSHSAVRQH---QGTMVEKIIPHPLYSAQNHDY----DVA 300

  Fly   218 LVELDRKAEFNDHVAAVCLPPDSGNDVQ--QVTAAGWGFT--ADGVKSSHLLKVNLQRFSDEVCQ 278
            |::|.....|:|.|:|||||....:..|  |...:|||.|  :....|..|....:...|.::|.
  Rat   301 LLQLRTPINFSDTVSAVCLPAKEQHFPQGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTDLCN 365

  Fly   279 KRLRFS-IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK----QVIGIVSYGLVCGSQG 338
            ....:| ..|....|||.:..:||.|.||||||:.       |..    .::|:||:|..|....
  Rat   366 SSCMYSGALTHRMLCAGYLDGRADACQGDSGGPLV-------CPSGDTWHLVGVVSWGRGCAEPN 423

  Fly   339 LPSVYTKVHLYTDWIESIV 357
            .|.||.||..:.|||...|
  Rat   424 RPGVYAKVAEFLDWIHDTV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/264 (29%)
Tryp_SPc 102..353 CDD:214473 75/261 (29%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 14/71 (20%)
Tryp_SPc 208..441 CDD:238113 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.