DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and F7

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_690059.1 Gene:F7 / 260320 RGDID:628678 Length:446 Species:Rattus norvegicus


Alignment Length:380 Identity:110/380 - (28%)
Similarity:154/380 - (40%) Gaps:96/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNGTGECKELTPS---DCPVIF--------YNQHLIGA-EVKYCDEFNDIVCCPIPLDHQNLKP 75
            |.|| |.|::...|   .||:.|        .|:.||.| |...||::     |   .||...| 
  Rat    96 CQNG-GTCQDHLKSYVCFCPLDFEGRNCEKNKNEQLICANENGDCDQY-----C---RDHVGTK- 150

  Fly    76 AEQT---------RPFEKQCKQYNEVRSACQSTPF------------IVGGTKASGKEFPFMALI 119
              :|         :|.|..||.  :|...|...|.            ||||......|.|:.|::
  Rat   151 --RTCSCHEDYVLQPDEVSCKP--KVEYPCGRIPVVEKRNFSRPQGRIVGGYVCPKGECPWQAVL 211

  Fly   120 GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKF------VVRLGEL 178
                    |.:....||..::..::::|||||              ||  ||      .|.|||.
  Rat   212 --------KFNEALLCGAVLLDTRWIVTAAHC--------------FD--KFGKLVNITVVLGEH 252

  Fly   179 DYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPD--SG 241
            |::....   .:..|:|..|:.|...|.....   :|||||.|.|...|.|:|..:|||..  |.
  Rat   253 DFSEKEG---TEQVRLVEQVIMPNKYTRGRTD---HDIALVRLHRPVTFTDYVVPLCLPERAFSE 311

  Fly   242 NDVQQV---TAAGWGFTAD-GVKSSHLLKVNLQRFSDEVCQKRLRFSID----TRTQFCAGSMSS 298
            |.:..:   ..:|||...| |..:..|:.:.:.|...:.|.:..:.|.:    |...||||.|..
  Rat   312 NTLASIRFSRVSGWGQLLDRGATALELMVIEVPRLMTQDCLEHAKHSANTPRITENMFCAGYMDG 376

  Fly   299 QADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ..|.|.|||||| ...|  |.....:.|:||:|..|.:.|...|||:|..|.||:
  Rat   377 TKDACKGDSGGP-HATH--YHGTWYLTGVVSWGEGCAAIGHIGVYTRVSQYIDWL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/268 (31%)
Tryp_SPc 102..353 CDD:214473 81/266 (30%)
F7NP_690059.1 GLA 25..85 CDD:214503
EGF_CA 87..123 CDD:238011 9/27 (33%)
Tryp_SPc 194..430 CDD:238113 82/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.