DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and PAMR1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_056245.2 Gene:PAMR1 / 25891 HGNCID:24554 Length:737 Species:Homo sapiens


Alignment Length:424 Identity:99/424 - (23%)
Similarity:158/424 - (37%) Gaps:102/424 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SVVTEYCDNG-------------TGE-----------CKELTPSDC------------------- 38
            :||:.:|:|.             .||           |:|...||.                   
Human   326 TVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICIKACREPKISDLVRRRVLPMQVQSRETPLHQ 390

  Fly    39 --PVIFYNQHLIGAEVKY-CDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQST- 99
              ...|..|.|..|..|. ...|.|     :|:.:|:|....|........::....|..|..| 
Human   391 LYSAAFSKQKLQSAPTKKPALPFGD-----LPMGYQHLHTQLQYECISPFYRRLGSSRRTCLRTG 450

  Fly   100 ----------PFI-----VGGTKASGKEFPFMALI-----GTHRPNKSKSDINWDCGGSVVHPKF 144
                      |..     :...|..|..:|:.|.|     |.|..:..|......|.|::|:.:.
Human   451 KWSGRAPSCIPICGKIENITAPKTQGLRWPWQAAIYRRTSGVHDGSLHKGAWFLVCSGALVNERT 515

  Fly   145 VLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEE 209
            |:.||||: ||..|...:    .:....|.||:...:...|:..:|..::...::||.||....:
Human   516 VVVAAHCV-TDLGKVTMI----KTADLKVVLGKFYRDDDRDEKTIQSLQISAIILHPNYDPILLD 575

  Fly   210 QGFKNDIALVELDRKAEFNDHVAAVCLPP--DSGNDVQQ--VTAAGWGFTAD----GVKSSHLLK 266
            .    |||:::|..||..:..|..:||..  |.....|:  :|.|||...||    |.|:..|..
Human   576 A----DIAILKLLDKARISTRVQPICLAASRDLSTSFQESHITVAGWNVLADVRSPGFKNDTLRS 636

  Fly   267 VNLQRFSDEVCQKR-----LRFSIDTRTQFCAG-SMSSQADTCNGDSGGPIFVQHPLYPCLK--- 322
            ..:......:|:::     :..|: |...|||. ..::.:|.|..::||...|..|.....:   
Human   637 GVVSVVDSLLCEEQHEDHGIPVSV-TDNMFCASWEPTAPSDICTAETGGIAAVSFPGRASPEPRW 700

  Fly   323 QVIGIV--SYGLVCGSQGLPSVYTKVHLYTDWIE 354
            .::|:|  ||...| |..|.:.:|||..:.||||
Human   701 HLMGLVSWSYDKTC-SHRLSTAFTKVLPFKDWIE 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/282 (26%)
Tryp_SPc 102..353 CDD:214473 71/279 (25%)
PAMR1NP_056245.2 CUB 128..234 CDD:238001
EGF_CA 240..272 CDD:238011
CCP 297..360 CDD:153056 6/33 (18%)
CCP <425..460 CDD:153056 4/34 (12%)
Tryp_SPc 478..735 CDD:238113 72/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.