DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG30025

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:266 Identity:69/266 - (25%)
Similarity:108/266 - (40%) Gaps:61/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            ||||:..:...||:...:   |:|           .||||:.....::||||||::..:..    
  Fly    31 IVGGSATTISSFPWQISLQRSGSH-----------SCGGSIYSSNVIVTAAHCLQSVSASV---- 80

  Fly   164 PNFDSPKFVVRLGELDYNS--TTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAE 226
                   ..:|.|...::|  .|       |.|.::..|.||:...    ..||||:::::....
  Fly    81 -------LQIRAGSSYWSSGGVT-------FSVSSFKNHEGYNANT----MVNDIAIIKINGALT 127

  Fly   227 FNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKS--SHLLKVNLQRFSDEVCQ-------KRLR 282
            |:..:.|:.|...:..:....:.:|||..:.|..|  |.|..||:...|...|.       .::|
  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192

  Fly   283 FSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVH 347
                 .|..||.  :|..|.|.||||||:.....|       :|:||:|..|.....|.||..|.
  Fly   193 -----STMICAA--ASGKDACQGDSGGPLVSGGVL-------VGVVSWGYGCAYSNYPGVYADVA 243

  Fly   348 LYTDWI 353
            ....|:
  Fly   244 ALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 69/266 (26%)
Tryp_SPc 102..353 CDD:214473 68/264 (26%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 68/264 (26%)
Tryp_SPc 31..252 CDD:238113 69/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.