DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG30002

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:339 Identity:101/339 - (29%)
Similarity:145/339 - (42%) Gaps:97/339 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IVC--CPIPLDHQNLK---PAEQTRPFEKQCKQYNEVRS----ACQSTPFIVGGTKASGKEFPFM 116
            |:|  || ||....::   |. |...:|...:|...|||    |.:....|.||.|:|....|:|
  Fly    14 ILCLTCP-PLSEAGMEDWTPG-QRLVYENLTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWM 76

  Fly   117 ALIGTHRPNKSKSDINW-DCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDY 180
            |.:      ...||:.. .||||::...||||||||.        ::.|.  |.:..|.|||||.
  Fly    77 AFL------HIASDLEMCRCGGSLISELFVLTAAHCF--------KMCPR--SKEIRVWLGELDL 125

  Fly   181 NSTTDDAL----------VQDFRVVNYVVH-------PGYDTEDEEQGFKNDIALVELDRKAEFN 228
            :||:|...          |::|.:..:::|       |||           ||||::|::|..|.
  Fly   126 SSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGY-----------DIALIKLNKKVVFK 179

  Fly   229 DHVAAVCLPPDS---------GNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFS 284
            ||:..:|||...         |   |:..|.|||            |....|:::...:      
  Fly   180 DHIRPICLPLTDELLAFTLQLG---QRFMAVGWG------------KTESLRYANSTME------ 223

  Fly   285 IDTRTQFCAGSMSSQ--------ADTCNGDSGGPIFVQHPLYPCLKQV-IGIVSYGLV-CGSQGL 339
            :|.||:.|.....:.        .||||||||||:..:..|:...:.| .|:||.|.. ||: |.
  Fly   224 VDIRTEKCTDGRDTSFLCASGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQNCGA-GH 287

  Fly   340 PSVYTKVHLYTDWI 353
            .:.|..|..|..||
  Fly   288 KAYYMDVPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 87/289 (30%)
Tryp_SPc 102..353 CDD:214473 85/287 (30%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 85/287 (30%)
Tryp_SPc 62..301 CDD:238113 85/287 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.