DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Ovch2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_766496.2 Gene:Ovch2 / 244199 MGIID:3045251 Length:609 Species:Mus musculus


Alignment Length:272 Identity:75/272 - (27%)
Similarity:118/272 - (43%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            ||||::.....:|:...:        |......|||:::..::|:|||||: .:.:.|..|:   
Mouse    52 IVGGSQVEKGSYPWQVSL--------KQKQKHICGGTIISSQWVITAAHCM-ANRNIALTLN--- 104

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
                  |..||.|.:......  |...:...::||.:.|   .:....||||:::....:|...|
Mouse   105 ------VTAGEHDLSQAEPGE--QTLAIETIIIHPQFST---RKPMIYDIALLKMAGTFQFGQFV 158

  Fly   232 AAVCLPPDSGNDVQQ---VTAAGWGFTADGVKSSHLL-KVNLQRFSDEVCQK---RLRFSIDTRT 289
            ..||| |:.|.....   .|.||||..::|.:...:| :|||...:.|.|:.   .|:..|..:|
Mouse   159 RPVCL-PEPGEHFNAGFICTTAGWGRLSEGGRLPQVLQQVNLPILTQEECEAVLLTLKNPITGKT 222

  Fly   290 QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK---QVIGIVSYGLVCG----------SQGLPS 341
            ..|.||.....|.|.|||||.:..|:     .|   .:.|:.|:||.||          .||.|.
Mouse   223 FLCTGSPDGGRDACQGDSGGSLMCQN-----RKGAWTLAGVTSWGLGCGRSWRNNARKKEQGSPG 282

  Fly   342 VYTKVHLYTDWI 353
            ::|.:.....||
Mouse   283 IFTDLRRVLPWI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 75/272 (28%)
Tryp_SPc 102..353 CDD:214473 73/270 (27%)
Ovch2NP_766496.2 Tryp_SPc 51..294 CDD:214473 73/270 (27%)
Tryp_SPc 52..297 CDD:238113 75/272 (28%)
CUB 317..420 CDD:238001
CUB 431..542 CDD:238001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.