DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Ctrb1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:269 Identity:79/269 - (29%)
Similarity:126/269 - (46%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHC-LETDESKAERLDPN 165
            ||.|..|....:|:...:      :.|:..:: ||||::...:|:||||| ::|.:         
  Rat    34 IVNGEDAIPGSWPWQVSL------QDKTGFHF-CGGSLISEDWVVTAAHCGVKTSD--------- 82

  Fly   166 FDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDH 230
                  ||..||.|..|  |:..:|..::.....:|.::...    .:|||.|::|...|:|::.
  Rat    83 ------VVVAGEFDQGS--DEENIQVLKIAQVFKNPKFNMFT----VRNDITLLKLATPAQFSET 135

  Fly   231 VAAVCLPPDSGNDVQQVT---AAGWGFTA-DGVKS-SHLLKVNLQRFSDEVCQKRLRFSIDTRTQ 290
            |:|||| |:..:|....|   ..|||.|. :.:|: ..|.:..|...|:..|:|.....| |...
  Rat   136 VSAVCL-PNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSWGSKI-TDVM 198

  Fly   291 FCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTD 351
            .|||  :|...:|.||||||:.       |.|.    :.||||:|....|...|:||::|.....
  Rat   199 TCAG--ASGVSSCMGDSGGPLV-------CQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTALMP 254

  Fly   352 WIESIVWGN 360
            |::.|:..|
  Rat   255 WVQQILEAN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/263 (29%)
Tryp_SPc 102..353 CDD:214473 76/260 (29%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 76/260 (29%)
Tryp_SPc 34..259 CDD:238113 77/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.