DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TPSD1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:239 Identity:71/239 - (29%)
Similarity:99/239 - (41%) Gaps:57/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINW--DCGGSVVHPKFVLTAAHCLETDES 157
            |.|.|. ||||.:|...::|:...:....|       .|  .||||::||::|||||||:|.|..
Human    32 ALQQTG-IVGGQEAPRSKWPWQVSLRVRGP-------YWMHFCGGSLIHPQWVLTAAHCVEPDIK 88

  Fly   158 KAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVV----NYVVHPGYDTEDEEQGFKNDIAL 218
            ....|       :..:|...|.|    .|.|:...|::    .|::..|           .||||
Human    89 DLAAL-------RVQLREQHLYY----QDQLLPVSRIIVHPQFYIIQTG-----------ADIAL 131

  Fly   219 VELDRKAEFNDHVAAVCLPPDSGN--DVQQVTAAGWGFTADGVKSSHL-----LK-VNLQRFSDE 275
            :||:.....:.|:..|.|||.|..  ........|||...:.|   ||     || |.:....:.
Human   132 LELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNV---HLPPPYPLKEVEVPVVENH 193

  Fly   276 VCQKRLRFSIDTRTQF--------CAGSMSSQADTCNGDSGGPI 311
            :|.......:.|...|        |||  |...|:|.||||||:
Human   194 LCNAEYHTGLHTGHSFQIVRDDMLCAG--SENHDSCQGDSGGPL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 68/232 (29%)
Tryp_SPc 102..353 CDD:214473 68/232 (29%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 68/232 (29%)
Tryp_SPc 38..240 CDD:214473 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.