DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Habp2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001316864.1 Gene:Habp2 / 226243 MGIID:1196378 Length:554 Species:Mus musculus


Alignment Length:404 Identity:114/404 - (28%)
Similarity:171/404 - (42%) Gaps:103/404 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DNGTGECKELTPSDC-------------------PVIFYNQHLI---------------G-AEVK 53
            |...|:..|:.|.||                   |.:::|.||:               | ||..
Mouse   174 DQYKGKFCEIGPDDCYVGDGYSYRGKVSKTVNQNPCLYWNSHLLLQETYNMFMEDAETHGIAEHN 238

  Fly    54 YCD---------------------EFNDIVCCPIPLDHQN-----LKPAEQTRPFEKQCKQYNEV 92
            :|.                     |:.|:..||:| |..|     |:|..:...|| .|.:....
Mouse   239 FCRNPDGDHKPWCFVKVNSEKVKWEYCDVTVCPVP-DTPNPVESLLEPVMELPGFE-SCGKTEVA 301

  Fly    93 RSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDES 157
            ..|.:.   |.||.|::..:.|:...:.|..|..:.......|||:::||.:|||||||  ||  
Mouse   302 EHAVKR---IYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGALIHPCWVLTAAHC--TD-- 359

  Fly   158 KAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVEL- 221
                    .::....|.||:.|...|  ::..|.|||...:.:..|:..||..  .|||||::| 
Mouse   360 --------INTKHLKVVLGDQDLKKT--ESHEQTFRVEKILKYSQYNERDEIP--HNDIALLKLK 412

  Fly   222 ---DRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRF 283
               ...|..:.:|..||||.|......:...:|||.|..|..|..||...::..::.:|..|..:
Mouse   413 PVGGHCALESRYVKTVCLPSDPFPSGTECHISGWGVTETGEGSRQLLDAKVKLIANPLCNSRQLY 477

  Fly   284 --SIDTRTQFCAGSMSSQ-ADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQGLPS 341
              :||. :..|||::... :|||.||||||:       .|.|.    |.||||:|..||.:  |.
Mouse   478 DHTIDD-SMICAGNLQKPGSDTCQGDSGGPL-------TCEKDGTYYVYGIVSWGQECGKK--PG 532

  Fly   342 VYTKVHLYTDWIES 355
            |||:|..:.:||::
Mouse   533 VYTQVTKFLNWIKT 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 87/265 (33%)
Tryp_SPc 102..353 CDD:214473 85/261 (33%)
Habp2NP_001316864.1 EGF_CA 67..103 CDD:238011
EGF_CA 150..182 CDD:238011 2/7 (29%)
KR 187..271 CDD:238056 12/83 (14%)
Tryp_SPc 308..547 CDD:238113 87/265 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.